PDB entry 4liw

View 4liw on RCSB PDB site
Description: CcmK1 Carboxysome Shell Protein from Synechocystis PCC6803, L11K Point Mutant
Class: transport protein
Keywords: bacterial microcompartment, carboxysome, BMC shell protein, transport protein, twinning, translational NCS
Deposited on 2013-07-03, released 2014-01-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbon dioxide-concentrating mechanism protein ccmK homolog 1
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Gene: ccmK1, sll1029
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72760 (Start-90)
      • engineered mutation (10)
      • expression tag (91-93)
    Domains in SCOPe 2.08: d4liwa1, d4liwa2
  • Chain 'B':
    Compound: Carbon dioxide-concentrating mechanism protein ccmK homolog 1
    Species: Synechocystis sp. PCC 6803 substr. Kazusa [TaxId:1111708]
    Gene: ccmK1, sll1029
    Database cross-references and differences (RAF-indexed):
    • Uniprot P72760 (Start-90)
      • engineered mutation (10)
      • expression tag (91)
    Domains in SCOPe 2.08: d4liwb1, d4liwb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4liwA (A:)
msiavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtag
ienirrvnggevlsnhiiarphenleyvlpilehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4liwA (A:)
iavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpileh

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4liwB (B:)
msiavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtag
ienirrvnggevlsnhiiarphenleyvlpilehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >4liwB (B:)
iavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpil