PDB entry 4lis

View 4lis on RCSB PDB site
Description: Crystal Structure of UDP-galactose-4-epimerase from Aspergillus nidulans
Class: Isomerase
Keywords: Catalysis, Hydrogen Bonding, Kinetics, Binding Sites, Protein Structure, Isomerase
Deposited on 2013-07-03, released 2013-10-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-10-23, with a file datestamp of 2013-10-18.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucose 4-epimerase
    Species: Aspergillus nidulans FGSC A4 [TaxId:227321]
    Gene: ANIA_04727, GALE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lisa_
  • Chain 'B':
    Compound: UDP-glucose 4-epimerase
    Species: Aspergillus nidulans FGSC A4 [TaxId:227321]
    Gene: ANIA_04727, GALE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lisb_
  • Chain 'C':
    Compound: UDP-glucose 4-epimerase
    Species: Aspergillus nidulans FGSC A4 [TaxId:227321]
    Gene: ANIA_04727, GALE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lisc_
  • Heterogens: UPG, NAD, GOL, IOD, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lisA (A:)
    mpsgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaql
    dvtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnv
    tnivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakk
    agneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgd
    dyashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafska
    vgrdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqq
    ppaelleqlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lisA (A:)
    psgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqld
    vtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvt
    nivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakka
    gneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgdd
    yashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskav
    grdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqp
    pael
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lisB (B:)
    mpsgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaql
    dvtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnv
    tnivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakk
    agneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgd
    dyashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafska
    vgrdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqq
    ppaelleqlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lisB (B:)
    sgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqldv
    tdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvtn
    ivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakkag
    neteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgddy
    ashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskavg
    rdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqpp
    ael
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lisC (C:)
    mpsgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaql
    dvtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnv
    tnivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakk
    agneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgd
    dyashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafska
    vgrdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqq
    ppaelleqlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lisC (C:)
    psgsvlvtggtgyigsfttlalleagykvvvadnlynssaealnrielisgkkaefaqld
    vtdeaafdkvfeahpdidsvihfaalkavgesgekpldyyhvnvygticllrsmvrhnvt
    nivfsssatvygdatrfpdmipipehcplgptnpygntkfaielaitdvinaqrnnakka
    gneteaakwngallryfnpagahpsgimgedpqgvpynllpllaqvatgkrekllvfgdd
    yashdgtairdyihildladghlkalnylrannpgvrawnlgtgrgstvyemirafskav
    grdlpyevaprragdvlnltsnptrantelgwkaqrtleqacedlwlwtknnpqgyrqqp
    pael