SCOPe 2.08: Structural Classification of Proteins

PDB entry 4lin

View 4lin on RCSB PDB site
Description: Exploring the atomic structure and conformational flexibility of a 320 angstrom long engineered viral fiber using X-ray crystallography
Deposited on 2013-07-02, released 2014-02-12
The last revision was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'B':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'C':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'D':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'E':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'F':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'G':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'H':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'I':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'J':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'K':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Chain 'L':
Compound: Tail needle protein gp26
Species: BACTERIOPHAGE P22 [TaxId:10754]
Database cross-references and differences (RAF-indexed):
- PDB 4LIN (Start-299)
Heterogens: CA, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>4linA (A:)
gpkvpefgssrmadpslnnpvviqatrldasilprnvfsksyllyviaqgtdvgaiagka
neagqgaydaqvkndeqdveladhearikqlridvddhesritantkaitalnvrvttae
geiaslqtnvsaldgrvttaennisalqadvddhesritantkaitalnvrvttaegeia
slqtnvsaldgrvttaennisalqadyvsktattsqslasplnvttsysvggkkvvgarq
tgwtaatgtankgvfdadltfavsdtytqseiqaianaliterrrtkaledalrahglid