PDB entry 4lif

View 4lif on RCSB PDB site
Description: Crystal structure of the JCV large T-antigen origin binding domain
Class: Hydrolase, dna binding protein
Keywords: origin binding domain, replication, polyomavirus, Hydrolase, dna binding protein
Deposited on 2013-07-02, released 2014-03-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.178
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: large t antigen
    Species: JC polyomavirus [TaxId:10632]
    Gene: large T antigen
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lifa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lifA (A:)
gskvedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhg
fgghnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesi
qgglkehdfnpe

    Sequence, based on observed residues (ATOM records): (download) 
    >4lifA (A:)
vedpkdfpvdlhaflsqavfsnrtvasfavyttkekaqilykklmekysvtfisrhgfgg
hnilffltphrhrvsainnycqklctfsflickgvnkeylfysalcrqpyavveesiqgg
lkehdfn