PDB entry 4li5

View 4li5 on RCSB PDB site
Description: EGFR-K IN COMPLEX WITH N-[3-[[5-chloro-4-(1H-indol-3-yl)pyrimidin-2-yl]amino]-4-methoxy-phenyl] Prop-2-enamide
Class: transferase/transferase inhibitor
Keywords: EGF RECEPTOR KINASE, INHIBITOR, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2013-07-02, released 2013-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.166
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (3-327)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4li5a1, d4li5a2
  • Heterogens: 1WY, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4li5A (A:)
    gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4li5A (A:)
    gsmgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdeddvvdad
    eylipq