PDB entry 4li4

View 4li4 on RCSB PDB site
Description: Crystal structure of HCoV-OC43 N-NTD complexed with AMP
Deposited on 2013-07-02, released 2014-05-28
The last revision was dated 2014-05-28, with a file datestamp of 2014-05-23.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.25
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Human coronavirus [TaxId:31631]
    Gene: N
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6SA23 (2-135)
      • expression tag (0-1)
  • Heterogens: AMP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4li4A (A:)
    efnvvpyyswfsgitqfqkgkefefvegqgvpiapgvpateakgywyrhnrrsfktadgn
    qrqllprwyfyylgtgphakdqygtdidgvywvasnqadvntpadivdrdpssdeaiptr
    fppgtvlpqgyyiegs
    

    Sequence, based on observed residues (ATOM records):
    >4li4A (A:)
    efnvvpyyswfsgitqfqkgkefefvegqgvpiapgvpateakgywyrhnrrsfktadgq
    llprwyfyylgtgphakdqygtdidgvywvasnqadvntpadivdrdpssdeaiptrfpp
    gtvlpqgyyiegs