PDB entry 4li2

View 4li2 on RCSB PDB site
Description: Crystal Structures of Lgr4 and its complex with R-spondin1
Class: Hormone Receptor/Signaling protein
Keywords: LRR, Hormone Receptor-Signaling protein complex
Deposited on 2013-07-02, released 2013-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Leucine-rich repeat-containing G-protein coupled receptor 4
  Species: Xenopus (Silurana) tropicalis [TaxId:8364]
  Gene: LGR4
  Database cross-references and differences (RAF-indexed):
  • Uniprot B0BLW3
    • engineered mutation (199)
• Chain 'B':
  Compound: r-spondin-1
  Species: Homo sapiens [TaxId:9606]
  Gene: R-spondin1, RSPO1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2MKA7 (Start-111)
  Domains in SCOPe 2.08: d4li2b_

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >4li2B (B:)
  saegsqacakgcelcsevngclkcspklfillerndirqvgvclpscppgyfdarnpdmn
  kcikckiehceacfshnfctkckeglylhkgrcypacpegssaangtmecss
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4li2B (B:)
  sqacakgcelcsevngclkcspklfilleqvgvclpscppgyfdarnpdmnkcikckieh
  ceacfshnfctkckeglylhkgrcypacpegssaangtmecss