PDB entry 4lhl

View 4lhl on RCSB PDB site
Description: Structure of the N-terminal domain of the Flo1 adhesin (N-Flo1p) from the yeast Saccharomyces cerevisiae
Class: cell adhesion
Keywords: PA14 domain, CELL ADHESION
Deposited on 2013-07-01, released 2014-09-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.43 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flocculation protein FLO1
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Gene: FLO1, FLO2, FLO4, FLO8, YAR050W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32768 (Start-248)
      • expression tag (249-252)
    Domains in SCOPe 2.07: d4lhla1, d4lhla2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lhlA (A:)
    sgateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisid
    ynipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtg
    yflppqtgsytfkfatvddsailsvggatafnccaqqqppitstnftidgikpwggslpp
    niegtvymyagyyypmkvvysnavswgtlpisvtlpdgttvsddfegyvysfdddlsqsn
    ctvpdpsnylevlfqgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhlA (A:)
    ateaclpagqrksgmninfyqyslkdsstysnaaymaygyasktklgsvggqtdisidyn
    ipcvsssgtfpcpqedsygnwgckgmgacsnsqgiaywstdlfgfyttptnvtlemtgyf
    lppqtgsytfkfatvddsailsvggatafnccaqqqppitstnftidgikpslppniegt
    vymyagyyypmkvvysnavswgtlpisvtlpdgttvsddfegyvysfdddlsqsnctvpd
    psnylevl