PDB entry 4lhk

View 4lhk on RCSB PDB site
Description: Structure of the N-terminal domain of the Lg-Flo1 adhesin (N-Lg-Flo1p) from the yeast Saccharomyces pastorianus, in complex with calcium and alpha-1,2-mannobiose
Class: cell adhesion
Keywords: PA14 domain, CELL ADHESION
Deposited on 2013-07-01, released 2014-09-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: 0.14
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flocculin
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: Lg-FLO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IUB3 (Start-190)
      • see remark 999 (35)
      • see remark 999 (191-219)
    Domains in SCOPe 2.05: d4lhka_
  • Chain 'B':
    Compound: Flocculin
    Species: Saccharomyces pastorianus [TaxId:27292]
    Gene: Lg-FLO1
    Database cross-references and differences (RAF-indexed):
    • Uniprot B3IUB3 (Start-190)
      • see remark 999 (35)
      • see remark 999 (191-219)
    Domains in SCOPe 2.05: d4lhkb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lhkA (A:)
    sgstqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiy
    ydlntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvgg
    siafeccaqeqppitstdftingikpwgaaaptdikgstymyagyyypikivysnakala
    rlpvsvvlpdgtevnddfegyvysfdddlsqsnctipdpskhttslevlfqgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhkA (A:)
    tqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiyydl
    ntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvggsia
    feccaqeqppitstdftingikpwgaaaptdikgstymyagyyypikivysnakalarlp
    vsvvlpdgtevnddfegyvysfdddlsqsnctipdps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lhkB (B:)
    sgstqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiy
    ydlntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvgg
    siafeccaqeqppitstdftingikpwgaaaptdikgstymyagyyypikivysnakala
    rlpvsvvlpdgtevnddfegyvysfdddlsqsnctipdpskhttslevlfqgphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lhkB (B:)
    tqaclpvgsrkngmnvnfykyslqdsttysdpqymaykysdtkklgsvsgqthlsiyydl
    ntafwntaswssdlfgfyttptnvtvemtgyflppqtgsytfkfatvddsailsvggsia
    feccaqeqppitstdftingikpwgaaaptdikgstymyagyyypikivysnakalarlp
    vsvvlpdgtevnddfegyvysfdddlsqsnctipdps