PDB entry 4lhf

View 4lhf on RCSB PDB site
Description: crystal structure of a dna binding protein from phage p2
Deposited on 2013-07-01, released 2014-03-05
The last revision was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein cox
    Species: ENTEROBACTERIA PHAGE P2 [TaxId:10679]
    Gene: cox
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lhfA (A:)
mskqvtlmtdaipyqefakligkstgavrrmidkgklpvidmtdpqsasgrageywvylp
awnnglklayesrpkeirdgwlmwlglgepr

    Sequence, based on observed residues (ATOM records):
    >4lhfA (A:)
lmtdaipyqefakligkstgavrrmidkgklpvidmtdpqsasageywvylpawnnglkl
ayesrpkeirdgwlmwlgl