PDB entry 4lh9

View 4lh9 on RCSB PDB site
Description: Crystal structure of the refolded hood domain (Asp256-Gly295) of HetR
Deposited on 2013-07-01, released 2013-07-17
The last revision was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.276
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heterocyst differentiation control protein
    Species: Nostoc [TaxId:103690]
    Gene: hetR
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lh9A (A:)
dvpperwdeamqeldeiirtwadkyhqvggipmilqmvfg