PDB entry 4lgu

View 4lgu on RCSB PDB site
Description: Crystal structure of clAP1 BIR3 bound to T3226692
Class: Ligase/Ligase inhibitor
Keywords: lAP family, 3 BIR repeats, CARD domain, 1 RING-type zinc finger, Ligase-Ligase inhibitor complex
Deposited on 2013-06-28, released 2013-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lgua_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: API1, BIRC2, IAP2, MIHB, RNF48
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13490 (22-114)
      • expression tag (21)
    Domains in SCOPe 2.08: d4lgub1, d4lgub2
  • Heterogens: ZN, 1YH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4lguA (A:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4lguA (A:)
nlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgddp
wvehakwfprceflirmkgqefvdeiqgry

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4lguB (B:)
mgsshhhhhhssgenlyfqggssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyy
vgrnddvkcfccdgglrcwesgddpwvehakwfprceflirmkgqefvdeiqgry

    Sequence, based on observed residues (ATOM records): (download) 
    >4lguB (B:)
ssisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwes
gddpwvehakwfprceflirmkgqefvdeiqgry