PDB entry 4lg7

View 4lg7 on RCSB PDB site
Description: Crystal structure MBD4 MBD domain in complex with methylated CpG DNA
Deposited on 2013-06-27, released 2013-07-17
The last revision was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.214
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-CpG-binding domain protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: MBD4, MED1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(5cm)p*gp*tp*tp*gp*gp*c)-3')
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*cp*ap*ap*(5cm)p*gp*tp*tp*gp*gp*c)-3')
    Species: synthetic, synthetic
  • Heterogens: UNX

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lg7A (A:)
grksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslkpedf
dftvlskr

    Sequence, based on observed residues (ATOM records):
    >4lg7A (A:)
rksvpcgwervvkqrlfgktagrfdvyfispqglkfrsksslanylhkngetslkpedfd
ftv

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.