PDB entry 4lg3

View 4lg3 on RCSB PDB site
Description: crystal structure of a duf487 family protein (despig_00776) from desulfovibrio piger atcc 29098 at 2.49 a resolution
Deposited on 2013-06-27, released 2013-08-21
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Desulfovibrio piger [TaxId:411464]
    Gene: DESPIG_00776
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Desulfovibrio piger [TaxId:411464]
    Gene: DESPIG_00776
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Uncharacterized protein
    Species: Desulfovibrio piger [TaxId:411464]
    Gene: DESPIG_00776
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lg3A (A:)
    gdeqseaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatv
    iaaaryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatp
    rgltaqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqe
    wtr
    

    Sequence, based on observed residues (ATOM records):
    >4lg3A (A:)
    seaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatviaaa
    ryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatprglt
    aqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqewtr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4lg3B (B:)
    gdeqseaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatv
    iaaaryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatp
    rgltaqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqe
    wtr
    

    Sequence, based on observed residues (ATOM records):
    >4lg3B (B:)
    seaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatviaaa
    ryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatprglt
    aqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqewtr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4lg3C (C:)
    gdeqseaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatv
    iaaaryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatp
    rgltaqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqe
    wtr
    

    Sequence, based on observed residues (ATOM records):
    >4lg3C (C:)
    eqseaqffaptkespyegipgrlrynvrivlveqdkqgnyiarrdsstvskrqlaatvia
    aaryyaqekraavvsitldsqpgpafgktvlatatyapdgkgvsgsddwtwntlqatprg
    ltaqelkiqclwgemrgkfqvdgstderrlkaaiakklkipaekvmlnpvfpepfpqewt
    r