PDB entry 4lft

View 4lft on RCSB PDB site
Description: Structure of alpha-elapitoxin-Dpp2d isolated from Black Mamba (Dendroaspis polylepis) venom
Class: toxin
Keywords: Long neurotoxin, three-finger-toxin, disulfide-rich, acetylcholine receptor inhibitor activity, expressed by the venom gland, toxin
Deposited on 2013-06-27, released 2014-06-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-06-11, with a file datestamp of 2014-06-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Alpha-elapitoxin-Dpp2a
  Species: Dendroaspis polylepis polylepis [TaxId:8620]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01396 (0-End)
    • see remark 999 (29)
    • see remark 999 (61)
    • see remark 999 (63)
  Domains in SCOPe 2.04: d4lfta_
• Chain 'B':
  Compound: Alpha-elapitoxin-Dpp2a
  Species: Dendroaspis polylepis polylepis [TaxId:8620]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01396 (0-71)
    • see remark 999 (29)
    • see remark 999 (61)
    • see remark 999 (63)
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4lftA (A:)
  rtcnktfsdqskicppgenicytktwcdafcsqrgkrvelgcaatcpkvkagveikccst
  dncnkfqfgkpr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4lftA (A:)
  rtcnktfsdqskicppgenicytktwcdafcsqrgkrvelgcaatcpkvkagveikccst
  dncn
  

  
  
• Chain 'B':
  No sequence available.