PDB entry 4lfs

View 4lfs on RCSB PDB site
Description: High resolution x-ray structure of racemic ShK toxin
Deposited on 2013-06-27, released 2013-08-14
The last revision was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.145
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel toxin shk
    Species: Stichodactyla helianthus, synthetic [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lfsA (A:)
    rscidtipksrctafqckhsmkyrlsfcrktcgtc