PDB entry 4lfq

View 4lfq on RCSB PDB site
Description: high resolution x-ray crystal structure of l-shk toxin
Deposited on 2013-06-27, released 2013-08-14
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel toxin shk
    Species: Stichodactyla helianthus, synthetic [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4lfqA (A:)
rscidtipksrctafqckhsmkyrlsfcrktcgtc