PDB entry 4lfm

View 4lfm on RCSB PDB site
Description: Crystal Structure of D-galactose-6-phosphate isomerase in complex with D-psicose
Class: Isomerase
Keywords: Rossmann-like alpha-beta-alpha sandwich fold, Rossmann Fold, Isomerase, Sugar-phosphate Binding, Isomerization
Deposited on 2013-06-27, released 2013-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.227
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose-6-phosphate isomerase subunit A
    Species: Lactobacillus rhamnosus [TaxId:568704]
    Gene: lacA, LC705_00641
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lfma_
  • Chain 'B':
    Compound: Galactose-6-phosphate isomerase subunit B
    Species: Lactobacillus rhamnosus [TaxId:568704]
    Gene: lacB, LC705_00640
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lfmb_
  • Chain 'C':
    Compound: Galactose-6-phosphate isomerase subunit A
    Species: Lactobacillus rhamnosus [TaxId:568704]
    Gene: lacA, LC705_00641
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lfmc_
  • Chain 'D':
    Compound: Galactose-6-phosphate isomerase subunit B
    Species: Lactobacillus rhamnosus [TaxId:568704]
    Gene: lacB, LC705_00640
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lfmd_
  • Heterogens: PSJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lfmA (A:)
    mgsshhhhhhssglvprgshmdviigadkdgfamkeqvkkyleehqyrvadvtpepaedf
    vesslavtkkllnsdahkaimfdrygvgsamasnkvkgmvtavveeentahmtaehngak
    aiaigtgitgydralviiqryldteyaggrhqirldmlekmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lfmA (A:)
    mdviigadkdgfamkeqvkkyleehqyrvadvtpepaedfvesslavtkkllnsdahkai
    mfdrygvgsamasnkvkgmvtavveeentahmtaehngakaiaigtgitgydralviiqr
    yldteyaggrhqirldmlekmi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lfmB (B:)
    miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl
    givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv
    kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lfmC (C:)
    mgsshhhhhhssglvprgshmdviigadkdgfamkeqvkkyleehqyrvadvtpepaedf
    vesslavtkkllnsdahkaimfdrygvgsamasnkvkgmvtavveeentahmtaehngak
    aiaigtgitgydralviiqryldteyaggrhqirldmlekmi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lfmC (C:)
    mdviigadkdgfamkeqvkkyleehqyrvadvtpepaedfvesslavtkkllnsdahkai
    mfdrygvgsamasnkvkgmvtavveeentahmtaehngakaiaigtgitgydralviiqr
    yldteyaggrhqirldmlekmi
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lfmD (D:)
    miiaigndhivtmqkieisnmlkdmgytvidegtydthrthypiygkkvaedvadgradl
    givmcgtgigistaadknegiraamcddvtsavyareqlnanvlgiggavvgvhliqdiv
    kayldatyketpenkklidkidniakpnpdqkdnphffdaelekwaegvyhd