PDB entry 4lf3
View 4lf3 on RCSB PDB site
Description: Inhibitory Mechanism of an Allosteric Antibody Targeting the Glucagon Receptor
Class: immune system
Keywords: Fab fragment, GCGR, IMMUNE SYSTEM
Deposited on
2013-06-26, released
2013-11-13
The last revision prior to the SCOPe 2.04 freeze date was dated
2014-01-01, with a file datestamp of
2013-12-27.
Experiment type: XRAY
Resolution: 2.73 Å
R-factor: 0.212
AEROSPACI score: 0.2
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Fab heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Anti GCGR mAb
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d4lf3a1, d4lf3a2 - Chain 'B':
Compound: Fab light chain
Species: Mus musculus [TaxId:10090]
Gene: Anti GCGR mAb
Database cross-references and differences (RAF-indexed):
- Chain 'C':
Compound: Glucagon receptor
Species: Homo sapiens [TaxId:9606]
Gene: GCGR
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: Fab heavy chain
Species: Mus musculus [TaxId:10090]
Gene: Anti GCGR mAb
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d4lf3d1, d4lf3d2 - Chain 'E':
Compound: Fab light chain
Species: Mus musculus [TaxId:10090]
Gene: Anti GCGR mAb
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: Glucagon receptor
Species: Homo sapiens [TaxId:9606]
Gene: GCGR
Database cross-references and differences (RAF-indexed):
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4lf3A (A:)
diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec
- Chain 'B':
No sequence available.
- Chain 'C':
No sequence available.
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>4lf3D (D:)
diqmtqspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslesgvps
rfsgsgsgteftltissvqpedfvtyyclqhnsnpltfgggtkveikrtvaapsvfifpp
sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
lskadyekhkvyacevthqglsspvtksfnrgec
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.