PDB entry 4lf2

View 4lf2 on RCSB PDB site
Description: Hexameric Form II RuBisCO from Rhodopseudomonas palustris, activated and complexed with sulfate and magnesium
Class: lyase, oxidoreductase
Keywords: Form II, CbbM 2-CABP, Transition-State Analog, Reaction Intermediate Analogue, photosynthesis, photosynthetic carbon fixation, lyase, oxidoreductase
Deposited on 2013-06-26, released 2014-06-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-06-25, with a file datestamp of 2014-06-20.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.205
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2a1, d4lf2a2
  • Chain 'B':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2b1, d4lf2b2
  • Chain 'C':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2c1, d4lf2c2
  • Chain 'D':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2d1, d4lf2d2
  • Chain 'E':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2e1, d4lf2e2
  • Chain 'F':
    Compound: Ribulose bisphosphate carboxylase
    Species: Rhodopseudomonas palustris [TaxId:258594]
    Gene: cbbM, RPA4641, Rpal_5122
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lf2f1, d4lf2f2
  • Heterogens: MG, SO4, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lf2A (A:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2A (A:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lf2B (B:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2B (B:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lf2C (C:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2C (C:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4lf2D (D:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2D (D:)
    mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
    tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
    yakmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfana
    cydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhye
    mlargefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqs
    krgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlg
    mnpttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkq
    gadpvefakdhrefarafesfpqdadklypnwraklk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4lf2E (E:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2E (E:)
    dqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevstt
    ddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdvey
    akmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanac
    ydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyem
    largefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqsk
    rgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgm
    npttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqg
    adpvefakdhrefarafesfpqdadklypnwrakl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4lf2F (F:)
    mgsshhhhhhssglvprgshmdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfi
    qtaahfaaesstgtnvevsttddftrgvdalvyevdeanslmkiaypielfdrnvidgra
    miasfltltignnqgmgdveyakmydfyvppaylklfdgpsttikdlwrvlgrpvinggf
    ivgtiikpklglrpqpfanacydfwlggdfikndepqgnqvfapfkdtvravadamrraq
    dktgeaklfsfnitaddhyemlargefiletfadnadhiaflvdgyvagpaavttarraf
    pkqylhyhraghgavtspqskrgytafvlskmarlqgasgihtgtmgfgkmegeaadrai
    aymitedaadgpyfhqewlgmnpttpiisggmnalrmpgffdnlghsnlimtagggafgh
    vdggaagakslrqaeqcwkqgadpvefakdhrefarafesfpqdadklypnwraklkpqa
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lf2F (F:)
    dqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevstt
    ddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdvey
    akmydfyvppaylklfdgpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanac
    ydfwlggdfikndepqgnqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyem
    largefiletfadnadhiaflvdgyvagpaavttarrafpkqylhyhraghgavtspqsk
    rgytafvlskmarlqgasgihtgtmgfgkmegeaadraiaymitedaadgpyfhqewlgm
    npttpiisggmnalrmpgffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqg
    adpvefakdhrefarafesfpqdadklypnwraklk