PDB entry 4lez

View 4lez on RCSB PDB site
Description: structure of mouse cgas bound to an 18bp dna and cgas product
Deposited on 2013-06-26, released 2013-12-25
The last revision was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyclic GMP-AMP synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Mb21d1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cyclic GMP-AMP synthase
    Species: Mus musculus [TaxId:10090]
    Gene: Mb21d1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 18bp dsDNA
    Species: synthetic, synthetic
  • Chain 'F':
    Compound: 18bp dsDNA
    Species: synthetic, synthetic
  • Chain 'I':
    Compound: 18bp dsDNA
    Species: synthetic, synthetic
  • Chain 'J':
    Compound: 18bp dsDNA
    Species: synthetic, synthetic
  • Heterogens: ZN, 1SY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lezA (A:)
    gsrkepdklkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyy
    ehvkisapnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatk
    mlskfrkiikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpis
    tkeglpiqgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgie
    ktccessgakccrkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwd
    prnlsscfdkllaffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngf
    pifdkl
    

    Sequence, based on observed residues (ATOM records):
    >4lezA (A:)
    klkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvkisa
    pnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatkmlskfrk
    iikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkeglpi
    qgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektccess
    gakccrkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlssc
    fdkllaffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdkl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >4lezC (C:)
    gsrkepdklkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyy
    ehvkisapnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatk
    mlskfrkiikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpis
    tkeglpiqgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgie
    ktccessgakccrkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwd
    prnlsscfdkllaffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngf
    pifdkl
    

    Sequence, based on observed residues (ATOM records):
    >4lezC (C:)
    klkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvkisa
    pnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatkmlskfrk
    iikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkeglpi
    qgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektccess
    gakccrkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlssc
    fdkllaffleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdkl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.