PDB entry 4ler

View 4ler on RCSB PDB site
Description: Crystal structure of a putative outer membrane protein, probably involved in nutrient binding (BVU_1254) from Bacteroides vulgatus ATCC 8482 at 1.42 A resolution
Class: sugar binding protein
Keywords: SusD homolog, SusD-like_2 family (PF12771), Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, SUGAR BINDING PROTEIN
Deposited on 2013-06-26, released 2013-07-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2013-07-10, with a file datestamp of 2013-07-05.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.145
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative outer membrane protein, probably involved in nutrient binding
    Species: Bacteroides vulgatus [TaxId:435590]
    Gene: BVU_1254
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4lera_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lerA (A:)
    gemnvdpnnatttnpsllltgvaysafnqtssdachaakmliltsgeskyqvykwtrgdf
    dyysnlrdvtkmseeagegsayqalahffranyfyqltldfgsipytdalkaetdanyqp
    aydsqevvlagilkeleeadkmlegsdeiisgdiiyngnlvnwrklinayrlrilmslsg
    kekvgdidvksefskivadgplmeslsdngqliyldqqdnrypyfndsdfgsgrfmdsty
    iaelatrqdprlfavatqtpnaekagkaindfssydggdpavpyslvndkavagncskpa
    pryyqtptnepmvllgyveqqlilaeavvrgwiqgddkiyyesavkasfefyqkyavsva
    dyltqdaaaeylrndkvayssslstdekieriimqkylptflqgsvwlpyyealrtgypd
    frraagvslpyrwmypqdeynnnathveaalneqfggsdktsdkpwwlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lerA (A:)
    tnpsllltgvaysafnqtssdachaakmliltsgeskyqvykwtrgdfdyysnlrdvtkm
    seeagegsayqalahffranyfyqltldfgsipytdalkaetdanyqpaydsqevvlagi
    lkeleeadkmlegsdeiisgdiiyngnlvnwrklinayrlrilmslsgkekvgdidvkse
    fskivadgplmeslsdngqliyldqqdnrypyfndsdfgsgrfmdstyiaelatrqdprl
    favatqtpnaekagkaindfssydggdpavpyslvndkavagncskpapryyqtptnepm
    vllgyveqqlilaeavvrgwiqgddkiyyesavkasfefyqkyavsvadyltqdaaaeyl
    rndkvayssslstdekieriimqkylptflqgsvwlpyyealrtgypdfrraagvslpyr
    wmypqdeynnnathveaalneqfggsdktsdkpwwlq