PDB entry 4leo

View 4leo on RCSB PDB site
Description: Crystal structure of anti-HER3 Fab RG7116 in complex with the extracellular domains of human Her3 (ERBB3)
Class: Transferase/Immune System
Keywords: Fab fragment, Therapeutic antibody, Her3 receptor, Transferase-Immune System complex
Deposited on 2013-06-26, released 2013-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.64 Å
R-factor: 0.23
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RG7116 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LEO (0-End)
  • Chain 'B':
    Compound: RG7116 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LEO (0-End)
    Domains in SCOPe 2.03: d4leob1, d4leob2
  • Chain 'C':
    Compound: Receptor tyrosine-protein kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB3, HER3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >4leoB (B:)
divmtqspdslavslgeratinckssqsvlnsgnqknyltwyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqsdysypytfgqgtkleikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrgec

    Sequence, based on observed residues (ATOM records): (download) 
    >4leoB (B:)
divmtqspdslavslgeratinckssqsvlnsgnqknyltwyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqsdysypytfgqgtkleikrtvaaps
vfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstys
lsstltlskadyekhkvyacevthqglsspvtksfnrge

  • Chain 'C':
    No sequence available.