PDB entry 4leg

View 4leg on RCSB PDB site
Description: human cathepsin k mutant c25s in complex with an allosteric modifier
Deposited on 2013-06-25, released 2014-02-12
Made obsolete by 5j94 on 2016-04-20

The last revision was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43235 (0-222)
      • engineered mutation (32)
  • Heterogens: 1XF, SO4, GOL, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4legA (A:)
yipewegrapdsvdyrkkgyvtpvknqgqcgsswafssvgalegqlkkktgkllnlspqn
lvdcvsendgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyre
ipegnekalkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiq
kgnkhwiiknswgenwgnkgyilmarnknnacgianlasfpkm