SCOPe 2.08: Structural Classification of Proteins

PDB entry 4lef

View 4lef on RCSB PDB site
Description: Crystal structure of PHOSPHOTRIESTERASE HOMOLOGY PROTEIN FROM ESCHERICHIA COLI complexed with phosphate in active site
Class: hydrolase
Keywords: PHP fold, HYDROLASE
Deposited on 2013-06-25, released 2014-06-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefa_
Chain 'B':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefb_
Chain 'C':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefc_
Chain 'D':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefd_
Chain 'E':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefe_
Chain 'F':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4leff_
Chain 'G':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefg_
Chain 'H':
Compound: phosphotriesterase homology protein
Species: Escherichia coli [TaxId:83333]
Gene: php, yhfV, b3379, JW3342
Database cross-references and differences (RAF-indexed):
- Uniprot P45548 (Start-291)
Domains in SCOPe 2.08: d4lefh_
Heterogens: ZN, PO4, BGC, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4lefA (A:)
msfdptgytlahehlhidlsgfknnvdcrldqyaficqemndlmtrgvrnviemtnrymg
rnaqfmldvmretginvvactgyyqdaffpehvatrsvqelaqemvdeieqgidgtelka
giiaeigtsegkitpleekvfiaaalahnqtgrpisthtsfstmgleqlallqahgvdls
rvtvghcdlkdnldnilkmidlgayvqfdtigknsyypdekriamlhalrdrgllnrvml
smditrrshlkanggygydyllttfipqlrqsgfsqadvdvmlrenpsqffq