PDB entry 4le9

View 4le9 on RCSB PDB site
Description: Crystal structure of a chimeric c-Src-SH3 domain
Class: Transferase
Keywords: beta shandwich, SH3, Kinase, Proly proline rich motifs, Phosphorylation, Transferase
Deposited on 2013-06-25, released 2014-05-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: 0.137
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (21-77)
      • expression tag (19-20)
      • engineered mutation (29-32)
      • engineered mutation (48-51)
      • engineered mutation (64)
    Domains in SCOPe 2.08: d4le9a1, d4le9a2
  • Heterogens: PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4le9A (A:)
    mgsshhhhhhssglvprgshmtfvalydyvasgetdlsfkkgerlqivgynhgdwwlahs
    lttgrtgyipsnyvapsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le9A (A:)
    hmtfvalydyvasgetdlsfkkgerlqivgynhgdwwlahslttgrtgyipsnyvapsd