PDB entry 4le6

View 4le6 on RCSB PDB site
Description: Crystal structure of the phosphotriesterase OPHC2 from Pseudomonas pseudoalcaligenes
Class: Hydrolase
Keywords: alpha beta/beta alpha sandwich, metallo-hydrolase, phosphotriesterase, Hydrolase
Deposited on 2013-06-25, released 2013-11-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.175
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas pseudoalcaligenes [TaxId:330]
    Gene: ophc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le6a_
  • Chain 'B':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas pseudoalcaligenes [TaxId:330]
    Gene: ophc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le6b_
  • Chain 'C':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas pseudoalcaligenes [TaxId:330]
    Gene: ophc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le6c_
  • Chain 'D':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas pseudoalcaligenes [TaxId:330]
    Gene: ophc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le6d_
  • Chain 'E':
    Compound: Organophosphorus hydrolase
    Species: Pseudomonas pseudoalcaligenes [TaxId:330]
    Gene: ophc2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4le6e_
  • Heterogens: GOL, EDO, PGE, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4le6A (A:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmaqqavapyakmnklkpyktegellpgvslvaspghtpghtsylfksggq
    sllvwgdillnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvrkeaqgyawvpvefspirsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le6A (A:)
    aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg
    vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh
    acglvnadgspaypnatvevpqaegellpgvslvaspghtpghtsylfksggqsllvwgd
    illnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkea
    qgyawvpvefspirsdr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4le6B (B:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmaqqavapyakmnklkpyktegellpgvslvaspghtpghtsylfksggq
    sllvwgdillnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvrkeaqgyawvpvefspirsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le6B (B:)
    aapaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekg
    vqtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdh
    acglvnadgspaypnatvevpqaellpgvslvaspghtpghtsylfksggqsllvwgdil
    lnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqg
    yawvpvefspirsdr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4le6C (C:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmaqqavapyakmnklkpyktegellpgvslvaspghtpghtsylfksggq
    sllvwgdillnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvrkeaqgyawvpvefspirsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le6C (C:)
    apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
    qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
    cglvnadgspaypnatvevpqaellpgvslvaspghtpghtsylfksggqsllvwgdill
    nhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgy
    awvpvefspirsdr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4le6D (D:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmaqqavapyakmnklkpyktegellpgvslvaspghtpghtsylfksggq
    sllvwgdillnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvrkeaqgyawvpvefspirsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le6D (D:)
    apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
    qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
    cglvnadgspaypnatvevpqllpgvslvaspghtpghtsylfksggqsllvwgdillnh
    avqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgyaw
    vpvefspirsd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4le6E (E:)
    mrlfslstalssamialvslplqaaapaqqktqvpgyyrmalgdfevtalydgyvdlpas
    llkgiddkdlqsllarmfvasekgvqtavnaylintgdnlvlidtgaaqcfgptlgvvqt
    nlkasgyqpeqvdtvllthlhpdhacglvnadgspaypnatvevpqaeaefwldeatmak
    apegmqgmfkmaqqavapyakmnklkpyktegellpgvslvaspghtpghtsylfksggq
    sllvwgdillnhavqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpgl
    ghvrkeaqgyawvpvefspirsdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4le6E (E:)
    apaqqktqvpgyyrmalgdfevtalydgyvdlpasllkgiddkdlqsllarmfvasekgv
    qtavnaylintgdnlvlidtgaaqcfgptlgvvqtnlkasgyqpeqvdtvllthlhpdha
    cglvnadgspaypnatvevpqllpgvslvaspghtpghtsylfksggqsllvwgdillnh
    avqfakpevvfefdvdsdqarqsrqrilaeaatdklwvagahlpfpglghvrkeaqgyaw
    vpvefspirsd