PDB entry 4ldn

View 4ldn on RCSB PDB site
Description: Crystal structure of a putative purine nucleoside phosphorylase from Vibrio fischeri ES114 (Target NYSGRC-029521)
Class: transferase
Keywords: Structural genomics, NYSGRC, PSI-Biology, New York Structural Genomics Research Consortium, TRANSFERASE
Deposited on 2013-06-24, released 2013-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Vibrio fischeri [TaxId:312309]
    Gene: deoD3, VF_A0968
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5DYV8 (22-End)
      • expression tag (16-21)
    Domains in SCOPe 2.07: d4ldna1, d4ldna2
  • Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ldnA (A:)
    mhhhhhhssgvdlgtenlyfqsmstphinapldafadtilmpgdplrakliaetylenvv
    qvtdvrgmlgftgefkgrkisvmghgmgapsasiyfhelmttykvknfirigscgaihdd
    vklkdlivaigastdskmnrirfkdndfaatanynmlsecvntlkttdinylvgnvfssd
    lfyrpdeeqydmmarygilgvemevnalysaaaenhcnavalctvtdhiknhehltader
    rtelheminvaldvalklpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ldnA (A:)
    nlyfqsmstphinapldafadtilmpgdplrakliaetylenvvqvtdvrgmlgftgefk
    grkisvmghgmgapsasiyfhelmttykvknfirigscgaihddvklkdlivaigastds
    kmnrirfkdndfaatanynmlsecvntlkttdinylvgnvfssdlfyrpdeeqydmmary
    gilgvemevnalysaaaenhcnavalctvtdhiknhehltaderrtelheminvaldval
    klpt