PDB entry 4ldm

View 4ldm on RCSB PDB site
Description: Crystal Structure of an RNA-free VP40 Octameric Ring
Class: viral protein
Keywords: ebolavirus matrix protein, RNA binding ring, viral transcription regulation, VIRAL PROTEIN
Deposited on 2013-06-24, released 2013-08-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-09-04, with a file datestamp of 2013-08-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: matrix protein vp40
    Species: Ebola virus [TaxId:186538]
    Gene: VP40
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ldma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ldmA (A:)
mahhhhhhvddddkgdtpsnplrpiaddtidhashtpgsvssafileamvnvisgpkvlm
kqipiwlplgvadqktysfdsttaaimlasytithfgkatnplvrvnrlgpgipdhplrl
lrignqaflqefvlppvqlpqyftfdltalklitqplpa

    Sequence, based on observed residues (ATOM records): (download) 
    >4ldmA (A:)
vssafileamvnvisgpkvlmkqipiwlplgvadqktysfdsttaaimlasytithfgka
tnplvrvnrlgpgipdhplrllrignqaflqefvlppvqlpqyftfdltalklitqplpa