PDB entry 4ldl

View 4ldl on RCSB PDB site
Description: Structure of beta2 adrenoceptor bound to hydroxybenzylisoproterenol and an engineered nanobody
Class: membrane protein/hydrolase
Keywords: G protein coupled receptor, MEMBRANE PROTEIN-HYDROLASE complex
Deposited on 2013-06-24, released 2013-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme, Beta-2 adrenergic receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: ADRB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (15-174)
      • expression tag (6-14)
      • engineered mutation (67)
      • engineered mutation (110)
      • linker (175-176)
    • Uniprot P07550 (177-383)
      • engineered mutation (244)
      • engineered mutation (246)
      • engineered mutation (335)
    • Uniprot P07550 (384-End)
      • engineered mutation (385)
  • Chain 'B':
    Compound: Camelid Antibody Fragment
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LDL (0-119)
    Domains in SCOPe 2.08: d4ldlb1, d4ldlb2
  • Heterogens: XQC, NA, 1WV, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ldlB (B:)
    qvqlqesggglvqaggslrlscaasgsifalnimgwyrqapgkqrelvaaihsggttnya
    nsvkgrftisrdnaantvylqmnslkpedtavyycnvkdfgaiiydydywgqgtqvtvss