PDB entry 4ldc

View 4ldc on RCSB PDB site
Description: Crystal Structure of DOC2B C2B domain
Class: metal binding protein
Keywords: C2, Calcium binding domain, METAL BINDING PROTEIN
Deposited on 2013-06-24, released 2013-09-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.128
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Double C2-like domain-containing protein beta
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Doc2b
  Database cross-references and differences (RAF-indexed):
  • Uniprot P70610 (1-148)
    • expression tag (0)
  Domains in SCOPe 2.03: d4ldca_
• Heterogens: CA, FLC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ldcA (A:)
  geergrilislkyssqkqgllvgivrcahlaamdangysdpyvktylkpdvdkkskhkta
  vkkktlnpefneefcyeikhgdlakktlevtvwdydigksndfiggvvlginakgerlkh
  wfdclknkdkrierwhtltneipgavlsd