PDB entry 4ld6

View 4ld6 on RCSB PDB site
Description: PWWP domain of human PWWP Domain-Containing Protein 2B
Deposited on 2013-06-24, released 2013-07-17
The last revision was dated 2013-07-17, with a file datestamp of 2013-07-12.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PWWP domain-containing protein 2B
    Species: Homo sapiens [TaxId:9606]
    Gene: PWWP2B, PWWP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6NUJ5 (1-116)
      • expression tag (0)
  • Heterogens: GOL, UNX, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4ld6A (A:)
    gqsvsecitedgrtvavgdivwgkihgfpwwparvldislgqkedgepswreakvswfgs
    pttsflsisklspfseffklrfnrkkkgmyrkaiteaanaarhvapeirelltqfet