PDB entry 4lcx

View 4lcx on RCSB PDB site
Description: The structure of hemagglutinin from avian-origin H7N9 influenza virus (A/Shanghai/1/2013)
Class: viral protein
Keywords: homotrimer, virus attachment and membrane fusion, VIRAL PROTEIN
Deposited on 2013-06-24, released 2013-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 3.09 Å
R-factor: 0.228
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-315)
    Domains in SCOPe 2.06: d4lcxa_
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-169)
    Domains in SCOPe 2.06: d4lcxb_
  • Chain 'C':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-315)
    Domains in SCOPe 2.06: d4lcxc_
  • Chain 'D':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-169)
    Domains in SCOPe 2.06: d4lcxd_
  • Chain 'E':
    Compound: hemagglutinin HA1
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-315)
    Domains in SCOPe 2.06: d4lcxe_
  • Chain 'F':
    Compound: hemagglutinin HA2
    Species: Influenza A virus [TaxId:11320]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCX (0-169)
    Domains in SCOPe 2.06: d4lcxf_
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxA (A:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxB (B:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxC (C:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxD (D:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxE (E:)
    dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
    tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
    rtngatsscrrsgssfyaemkwllsntdnaafpqmtksykntrknpalivwgihhsgsta
    eqtklygsgnklvtvgssnyqqsfvpspgartqvngqsgridfhwlmlnpndtvtfsfng
    afiapdrasflrgksmgiqsgvqvdadcegdcyysggtiisnlpfqnidsravgkcpryv
    kqrslllatgmknvpe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcxF (F:)
    glfgaiagfiengweglidgwygfrhqnaqgegtaadykstqsaidqitgklnrliektn
    qqfelidneftevekqignvinwtrdsitevwsynaellvamenqhtidladsemdklye
    rvkrqlrenaeedgtgcfeifhkcdddcmasirnntydhskyreeamqnr