PDB entry 4lcu

View 4lcu on RCSB PDB site
Description: Structure of KcsA with E118A mutation
Class: TRANSPORT PROTEIN, membrane protein
Keywords: Voltage Gated Potassium Channel, Potassium Channel, TRANSPORT PROTEIN, membrane protein, pH-gated potassium channel
Deposited on 2013-06-23, released 2013-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCU (0-218)
    Domains in SCOPe 2.07: d4lcua1, d4lcua2, d4lcua3
  • Chain 'B':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LCU (0-211)
    Domains in SCOPe 2.07: d4lcub1, d4lcub2
  • Chain 'C':
    Compound: pH-gated potassium channel KcsA
    Species: Streptomyces lividans [TaxId:1916]
    Gene: kcsA, skc1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A334
      • engineered mutation (124)
    Domains in SCOPe 2.07: d4lcuc_
  • Heterogens: K, DGA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcuA (A:)
    qvqlqqpgaelvkpgasvklsckasgytftsdwihwvkqrpghglewigeiipsygrany
    nekiqkkatltadkssstafmqlssltsedsavyycarergdgyfavwgagttvtvssak
    ttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdly
    tlsssvtvpssswpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lcuB (B:)
    dilltqspailsvspgervsfscrasqsigtdihwyqqrtngsprllikyasesisgips
    rfsgsgsgtdftlsinsvesedianyycqqsnrwpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4lcuC (C:)
    smhhhhhhppmlsgllarlvklllgrhgsalhwraagaatvllvivllagsylavlaerg
    apgaqlitypralwwsvetattvgygdlypvtlwgrlvavvvmvagitsfglvtaalatw
    fvgraqerrgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lcuC (C:)
    salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
    ypvtlwgrlvavvvmvagitsfglvtaalatwfvgraqerrg