PDB entry 4lck

View 4lck on RCSB PDB site
Description: co-crystal structure of a t-box riboswitch stem i domain in complex with its cognate trna
Deposited on 2013-06-21, released 2013-07-31
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribosomal protein YbxF
  Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
  Gene: rplGB, ybaB, ybxF, BSU01090
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46350 (0-80)
• Chain 'B':
  Compound: tRNA-Gly
  Species: Oceanobacillus iheyensis, synthetic [TaxId:182710]
  
• Chain 'C':
  Compound: t-box riboswitch stem I
  Species: Oceanobacillus iheyensis, synthetic [TaxId:182710]
  
• Chain 'D':
  Compound: Ribosomal protein YbxF
  Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
  Gene: rplGB, ybaB, ybxF, BSU01090
  Database cross-references and differences (RAF-indexed):
  • Uniprot P46350 (0-80)
• Chain 'E':
  Compound: tRNA-Gly
  Species: Oceanobacillus iheyensis, synthetic [TaxId:182710]
  
• Chain 'F':
  Compound: t-box riboswitch stem I
  Species: Oceanobacillus iheyensis, synthetic [TaxId:182710]
  
• Heterogens: SR, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >4lckA (A:)
  sydkvsqaksiiigtkqtvkalkrgsvkevvvakdadpiltssvvslaedqgisvsmves
  mkklgkacgievgaaavaiil
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records:
  

  >4lckD (D:)
  sydkvsqaksiiigtkqtvkalkrgsvkevvvakdadpiltssvvslaedqgisvsmves
  mkklgkacgievgaaavaiil
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.