PDB entry 4lci
View 4lci on RCSB PDB site
Description: Anti canine CD28 antibody, 1C6
Class: immune system
Keywords: Immunoglobulin, antibody, CD28, IMMUNE SYSTEM
Deposited on
2013-06-21, released
2014-06-25
The last revision prior to the SCOPe 2.05 freeze date was dated
2014-08-13, with a file datestamp of
2014-08-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.4
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: anti canine CD28 antibody, 1C6, heavy chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4lcih_ - Chain 'L':
Compound: anti canine CD28 antibody, 1C6, light chain
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4lcil_ - Heterogens: GOL, NA, FMT, HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>4lciH (H:)
qiqlvqsgpelkkpgetvkisckasgytftnygmtwvkqaprkglkwmgwintytgrpty
addfkgrfafsletsastaylqinnlkhedtatyfcaslgedfwgqgttltvsshhhhhh
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4lciL (L:)
mdivmtqaapsvpvtpgesvsiscrstksllhsngntylywflqrpgqspqrliyymsnl
asgvpdrfsgrgsgtdftlrisrveaedagvyycmqsleypytfgggtkleikrlvp