PDB entry 4lc3

View 4lc3 on RCSB PDB site
Description: X-ray crystal structure of a putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase from Burkholderia cenocepacia
Class: transferase
Keywords: Structural Genomics, NIAID, National Institute of Allergy and Infectious Diseases, Seattle Structural Genomics Center for Infectious Disease, SSGCID, TRANSFERASE
Deposited on 2013-06-21, released 2013-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-21, with a file datestamp of 2013-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.113
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: arnB, BceJ2315_18950, BCAL1931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lc3a_
  • Chain 'B':
    Compound: Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase
    Species: Burkholderia cenocepacia [TaxId:216591]
    Gene: arnB, BceJ2315_18950, BCAL1931
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4lc3b_
  • Heterogens: CIT, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lc3A (A:)
    mahhhhhhmsqttapflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycgg
    rpvrvfnsgtctleiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrn
    idldkleqaitprtkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkri
    gaigdlvsfsfhanknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggk
    ynltdvaarvglgqlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhm
    flvtlplerltitraefmaqmkergigtgihypaihlftlyrargfkegmfphaerygas
    tvtlplftqmtegdvrrvvdavnqiceqygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lc3A (A:)
    apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl
    eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr
    tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha
    nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg
    qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit
    raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg
    dvrrvvdavnqiceqygk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lc3B (B:)
    mahhhhhhmsqttapflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycgg
    rpvrvfnsgtctleiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrn
    idldkleqaitprtkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkri
    gaigdlvsfsfhanknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggk
    ynltdvaarvglgqlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhm
    flvtlplerltitraefmaqmkergigtgihypaihlftlyrargfkegmfphaerygas
    tvtlplftqmtegdvrrvvdavnqiceqygk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lc3B (B:)
    apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycggrpvrvfnsgtctl
    eiglriagvgpgdevittpaswvstsnviietgatpvfadidpvtrnidldkleqaitpr
    tkaiipvflsglpvdmdrlyaiarahklrviedaaqafgstwhgkrigaigdlvsfsfha
    nknlttieggalvlnnedeavlaqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglg
    qlphlerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltit
    raefmaqmkergigtgihypaihlftlyrargfkegmfphaerygastvtlplftqmteg
    dvrrvvdavnqiceqygk