PDB entry 4lc2
View 4lc2 on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRPF1B
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1, Protein Br140, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN
Deposited on
2013-06-21, released
2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-01-31, with a file datestamp of
2018-01-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Peregrin
Species: Homo sapiens [TaxId:9606]
Gene: BR140, BRPF1, BRPF1B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4lc2a_ - Heterogens: NO3, EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>4lc2A (A:)
smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
Sequence, based on observed residues (ATOM records): (download)
>4lc2A (A:)
emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg