PDB entry 4lc2

View 4lc2 on RCSB PDB site
Description: Crystal structure of the bromodomain of human BRPF1B
Class: DNA binding protein
Keywords: Bromodomain and PHD finger-containing protein 1, Protein Br140, Structural Genomics Consortium, SGC, DNA BINDING PROTEIN
Deposited on 2013-06-21, released 2013-07-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peregrin
    Species: Homo sapiens [TaxId:9606]
    Gene: BR140, BRPF1, BRPF1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4lc2a_
  • Heterogens: NO3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lc2A (A:)
    smemqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnlea
    yrylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lc2A (A:)
    emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
    ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekmg