PDB entry 4lc1

View 4lc1 on RCSB PDB site
Description: MeaB, A Bacterial Homolog of MMAA, Bound to GDP and crystallized in the presence of GDP and [AlF4]-
Class: chaperone
Keywords: Alpha and beta protein, Metallochaperone, CHAPERONE
Deposited on 2013-06-21, released 2013-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-13, with a file datestamp of 2013-11-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methylmalonyl-CoA mutase accessory protein
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: meaB, MexAM1_META1p0188
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5AP93 (Start-328)
      • conflict (191)
    Domains in SCOPe 2.08: d4lc1a_
  • Chain 'B':
    Compound: Methylmalonyl-CoA mutase accessory protein
    Species: Methylobacterium extorquens [TaxId:272630]
    Gene: meaB, MexAM1_META1p0188
    Database cross-references and differences (RAF-indexed):
    • Uniprot C5AP93 (Start-328)
      • conflict (191)
    Domains in SCOPe 2.08: d4lc1b_
  • Heterogens: GDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lc1A (A:)
    msatlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgi
    tgvpgvgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafi
    rpspssgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpga
    gdelqgikkgifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvti
    sglhgkgldslwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrq
    ataeaeravaggehspaagadaiatligllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lc1A (A:)
    tlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgv
    pgvgksttidalgslltaaghkvavlavdpssktrmarlaidrnafirpspssgtlggva
    aktretmllceaagfdvilvetvggqsetavadltdfflvlmlpgagdelqgikkgifel
    admiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisglhgkgldslwsr
    iedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqataeaeravaggeh
    spaagadaiatligl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4lc1B (B:)
    msatlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgi
    tgvpgvgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafi
    rpspssgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpga
    gdelqgikkgifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvti
    sglhgkgldslwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrq
    ataeaeravaggehspaagadaiatligllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lc1B (B:)
    tlpdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgv
    pgvgksttidalgslltaaghkvavlavdpssrmarlaidrnafirpspssgtlggvaak
    tretmllceaagfdvilvetvqsetavadltdfflvlmlpgelqgikkgifeladmiavn
    kaddgdgerrasaaaseyraalhiltppsatwtppvvtisglhgkgldslwsriedhrsk
    ltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqataeaeravaggehspaagad
    aiatligl