PDB entry 4lbw

View 4lbw on RCSB PDB site
Description: Identifying ligand binding hot spots in proteins using brominated fragments
Class: protein binding
Keywords: GTPase, PLANT PROTEIN, PROTEIN BINDING
Deposited on 2013-06-21, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.172
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: elongation factor tu-a
    Species: Thermus thermophilus [TaxId:274]
    Gene: tuf, tufA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60338 (Start-403)
      • conflict (262)
    Domains in SCOPe 2.07: d4lbwa1, d4lbwa2, d4lbwa3
  • Heterogens: GNP, MG, NH4, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4lbwA (A:)
    kgefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargi
    tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
    larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
    mhrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgr
    iergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreeverg
    qvlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvem
    vmpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lbwA (A:)
    gefvrtkphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargit
    intahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehill
    arqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqm
    hrnpktrrgenewvdkiwelldaideyiptpvrdvdkpflmpvedvftitgrgtvatgri
    ergkvkvgdeveivglapetrktvvtgvemhrktlqegiagdnvgvllrgvsreevergq
    vlakpgsitphtkfeasvyvlkkeeggrhtgffsgyrpqfyfrttdvtgvvqlppgvemv
    mpgdnvtftvelikpvaleeglrfaireggrtvgagvvtkile