PDB entry 4lbj

View 4lbj on RCSB PDB site
Description: Crystal structure of Human galectin-3 CRD K176L mutant in complex with LNT
Class: sugar binding protein
Keywords: galectin, carbohydrate-recognition, LNT, glycosphingolipid, beta sandwich, carbohydrate binding protein, SUGAR BINDING PROTEIN
Deposited on 2013-06-20, released 2014-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS3, MAC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17931 (1-137)
      • expression tag (0)
      • engineered mutation (63)
    Domains in SCOPe 2.08: d4lbja1, d4lbja2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lbjA (A:)
    mlivpynlplpggvvprmlitilgtvkpnanrialdfqrgndvafhfnprfnennrrviv
    cntlldnnwgreerqsvfpfesgkpfkiqvlvepdhfkvavndahllqynhrvkklneis
    klgisgdidltsasytmi