PDB entry 4lbd

View 4lbd on RCSB PDB site
Description: ligand-binding domain of the human retinoic acid receptor gamma bound to the synthetic agonist bms961
Deposited on 1998-02-04, released 1999-03-02
The last revision prior to the SCOP 1.57 freeze date was dated 1999-03-02, with a file datestamp of 1999-03-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d4lbd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4lbd_ (-)
    lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
    vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
    agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
    rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlen