PDB entry 4lbb

View 4lbb on RCSB PDB site
Description: Crystal structure of human alpha-defensin 1 (HNP1) I20A mutant
Deposited on 2013-06-20, released 2013-11-27
The last revision was dated 2013-11-27, with a file datestamp of 2013-11-22.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.202
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neutrophil defensin 1
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59665 (0-29)
    • engineered mutation (19)
• Chain 'B':
  Compound: Neutrophil defensin 1
  Species: HOMO SAPIENS, synthetic [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59665 (0-29)
    • engineered mutation (19)
• Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >4lbbA (A:)
  acycripaciagerrygtcayqgrlwafcc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records:
  

  >4lbbB (B:)
  acycripaciagerrygtcayqgrlwafcc