PDB entry 4lb8

View 4lb8 on RCSB PDB site
Description: crystal structure of a duf4848 family protein (bt3222) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution
Deposited on 2013-06-20, released 2013-07-10
The last revision was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Bacteroides thetaiotaomicron [TaxId:226186]
    Gene: BT_3222
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4lb8A (A:)
    gndeqevnmvkptnanseievindgtmikfkdvesyenallkvsamstseqvsflnslsf
    ksqmilmqeadgeldkicnqaadkaefdvlyekykhkygdvfmfntidatdlspysrlvy
    vaneyfvnmkgefmigdslvvdkvytdfkerqqqftvstrssvsdlssineaysrqkdrk
    vglylsvssgiihanftsqkkgvfgwsrysttyhakvnlrgfefaqgellgygpvyvnkd
    gipfaidtkemggnvtkvfgrklaqectgtieiwsrgvpydqrgfatvrl
    

    Sequence, based on observed residues (ATOM records):
    >4lb8A (A:)
    eievindgtmikfkdvesyenallkvsamstseqvsflnslsfksqmilmqeadgeldki
    cnqaadkaefdvlyekykhkygdvfmfntidatdlspysrlvyvaneyfvnmkgefmigd
    slvvdkvytdfkerqqqftvstrssvsdlssineaysrqkdrkvglylsvssgiihanft
    sqkkgvfgwsrysttyhakvnlrgfefaqgellgygpvyvnkdgipfaidtkemggnvtk
    vfgrklaqectgtieiwsrgvpydqrgfatvrl