PDB entry 4lb6

View 4lb6 on RCSB PDB site
Description: Crystal structure of PKZ Zalpha in complex with ds(CG)6 (tetragonal form)
Deposited on 2013-06-20, released 2013-09-18
The last revision was dated 2013-12-04, with a file datestamp of 2013-11-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Protein kinase containing Z-DNA binding domains
    Species: Danio rerio [TaxId:7955]
    Gene: pkz
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 5'-d(*tp*cp*gp*cp*gp*cp*gp*cp*gp*cp*gp*cp*g)-3'
    Species: synthetic, synthetic
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'B':
    Sequence, based on SEQRES records:
    >4lb6B (B:)
gshmassaeneiemricdylrrhgrstvqdifkelklekstvnrhlyslqaskqvfktve
dnkrpvwnlves

    Sequence, based on observed residues (ATOM records):
    >4lb6B (B:)
eneiemricdylrrhgrstvqdifkelklekstvnrhlyslqaskqvfktvednkrpvwn
lve

  • Chain 'C':
    No sequence available.