PDB entry 4las
View 4las on RCSB PDB site
Description: Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
Class: immune system
Keywords: methamphetamine, anti-methamphetamine antibody, therapeutic antibody, scFv, IMMUNE SYSTEM
Deposited on
2013-06-20, released
2013-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated
2013-12-11, with a file datestamp of
2013-12-06.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.164
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: Single heavy chain Variable fragment
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4lash_ - Chain 'L':
Compound: Single light chain Variable fragment
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d4lasl_ - Heterogens: 1WF, HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>4lasH (H:)
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvs
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>4lasL (L:)
ggggsqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnl
asgvparfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikra