PDB entry 4laq

View 4laq on RCSB PDB site
Description: Crystal structures of a therapeutic single chain antibody in the free Form and in complex with amphetamine and 4-hydroxymethamphetamine
Class: immune system
Keywords: methamphetamine, anti-methamphetamine antibody, therapeutic antibody, scFv, IMMUNE SYSTEM
Deposited on 2013-06-20, released 2014-01-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.21
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Single heavy chain variable fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LAQ (0-103)
    Domains in SCOPe 2.04: d4laqh_
  • Chain 'L':
    Compound: Single light chain variable fragment
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4LAQ (1-117)
    Domains in SCOPe 2.04: d4laql_
  • Heterogens: SO4, MLT, NI, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4laqH (H:)
qtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyynpslksrisitrdtsk
nqvylqlksvssedtatyycsyfdsddyameywgqgtsvtvsgg

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4laqL (L:)
sqivltqspaimsaspgekvtltcsasssvssshlywyqqkpgsspklwiystsnlasgv
parfsgsgsgtsysltissmeaedaasyfchqwssfpftfgsgtkleikraphhhhhh