PDB entry 4lah

View 4lah on RCSB PDB site
Description: Structure-Based Design of New Dihydrofolate Reductase Antibacterial Agents: 7-(Benzimidazol-1-yl)-2,4-diaminoquinazolines
Class: Oxidoreductase/Oxidoreductase inhibitor
Keywords: DHFR, protein-inhibitor complex, folate, NADPH, Oxidoreductase-Oxidoreductase inhibitor complex
Deposited on 2013-06-19, released 2014-02-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-02-26, with a file datestamp of 2014-02-21.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: dihydrofolate reductase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: folA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4lahx_
  • Heterogens: 1VO, NAP, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4lahX (X:)
    mtlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrn
    vvltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrg
    dtffppytfedwevassvegkldekntiphtflhlirkklehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4lahX (X:)
    tlsilvahdlqrvigfenqlpwhlpndlkhvkklstghtlvmgrktfesigkplpnrrnv
    vltsdtsfnvegvdvihsiediyqlpghvfifggqtlfeemidkvddmyitviegkfrgd
    tffppytfedwevassvegkldekntiphtflhlirk