PDB entry 4lad

View 4lad on RCSB PDB site
Description: Crystal Structure of the Ube2g2:RING-G2BR complex
Class: ligase/ligase
Keywords: E2:E3 complex, LIGASE-LIGASE complex
Deposited on 2013-06-19, released 2013-08-28
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 G2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2G2, Ubiquitin-conjugating enzyme E2G2 isoform 1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4lada_
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase AMFR
    Species: Homo sapiens [TaxId:9606]
    Gene: AMFR, Autocrine motility factor receptor, RNF45
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, OXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ladA (A:)
    magtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsf
    pldyplsppkmrftcemfhpniypdgrvcisilhapgddpmgyessaerwspvqsvekil
    lsvvsmlaepndesganvdaskmwrddreqfykiakqivqkslgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ladA (A:)
    gtalkrlmaeykqltlnppegivagpmneenffewealimgpedtcfefgvfpailsfpl
    dyplsppkmrftcemfhpniypdgrvcisilhapsaerwspvqsvekillsvvsmlaepn
    desganvdaskmwrddreqfykiakqivqkslgl
    

  • Chain 'B':
    No sequence available.