PDB entry 4l9n

View 4l9n on RCSB PDB site
Description: Crystal structure of MepR A103V mutant from multidrug resistant S. aureus clinical isolate
Class: transcription
Keywords: wing-helix-turn-helix, wHTH, transcription repression, TRANSCRIPTION
Deposited on 2013-06-18, released 2013-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (Start-138)
      • engineered mutation (102)
    Domains in SCOPe 2.07: d4l9na_
  • Chain 'B':
    Compound: MepR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: mepR
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5Y812 (Start-138)
      • engineered mutation (102)
      • expression tag (139)
    Domains in SCOPe 2.07: d4l9nb1, d4l9nb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4l9nA (A:)
    meftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l9nA (A:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdaqdtrkniglttsgiklvevftsifdemeqtlvsqlsee
    eneqmkanltkmlsslq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4l9nB (B:)
    meftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrt
    gptvsnllrnlerkkliyryvdaqdtrrkniglttsgiklvevftsifdemeqtlvsqls
    eeeneqmkanltkmlsslqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4l9nB (B:)
    eftysylfrmishemkqkadqkleqfditneqghtlgylyahqqdgltqndiakalqrtg
    ptvsnllrnlerkkliyryvdqdtrrkniglttsgiklvevftsifdemeqtlvsqlsee
    eneqmkanltkmlsslqh